SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NFQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NFQ6
Domain Number 1 Region: 76-376
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.26e-110
Family Pancreatic carboxypeptidases 0.0000031
Further Details:      
 
Domain Number 2 Region: 4-63
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000000000181
Family Pancreatic carboxypeptidase, activation domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NFQ6
Sequence length 380
Comment (tr|G1NFQ6|G1NFQ6_MELGA) Carboxypeptidase A6 {ECO:0000313|Ensembl:ENSMGAP00000011859} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CPA6 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
LVPALQVDLWQPSSTFHISEGTVIDVHVPQNTSRSLLPFLQQANIHYTILISDLQKAIEN
QTGQRASRHRRSLPAYNYEVYHSLEEIEEWMYYLNKTHSDLVHLFSVGKSYEGRPLFVLK
LGKRSRPYKKAVWIDCGIHAREWIGPAFCQWFVKEALQTYQTDPAMKKMLTQLYFYVMPV
FNVDGYHYSWTNDRFWRKTRSKNSRFWCYGVDANRNWKVKWCDEGASLHPCDDTYCGPFP
ESEPEVKAVAHFLRKHRKQIKAYLSFHAYAQMLLYPYSYKYATIPNFSCVESAAYNAVNA
LQSAYGVRYRYGPASSTLYVSSGSSMDWAYKNGIPYAFAFELRDTGHFGFLLPETLIRPT
CTETMLAVKNITFHLLKKCY
Download sequence
Identical sequences G1NFQ6
ENSMGAP00000011859 ENSMGAP00000011859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]