SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NFW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NFW6
Domain Number 1 Region: 881-1093
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.24e-54
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 1256-1442
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-26
Family Pleckstrin-homology domain (PH domain) 0.0000135
Further Details:      
 
Domain Number 3 Region: 1082-1203
Classification Level Classification E-value
Superfamily PH domain-like 6.54e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NFW6
Sequence length 1446
Comment (tr|G1NFW6|G1NFW6_MELGA) FYVE, RhoGEF and PH domain containing 6 {ECO:0000313|Ensembl:ENSMGAP00000011933} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=FGD6 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
FPSFLEIKKPPVAPKPKFVVGHKATPPPVAPKPDVMLSGVLQAARKTKPAVAPKPKVLKS
SSIPEVKPPSCARKGTKSFEEHRGDSSQTLDHLNYKNEVSEGGTDNTAYILPMSSCKFEC
FHKLGNGENTCKTQIILEHFENLENIKTGEKTALALGSSPSEKMANRNQVVVKASILEEK
LKDVLTHGVFPNRSPVRHRNADKLYKGDGNSSRNDVKIEFLELVQSSSEIANGRQQNTGS
KLTEDEFQTSETCPSLNENHSSCSCPPNQEILENENVNSSSLFSGEMGVKIDTDKTSSET
CSVLSSKMLPIPKPRKPRAACLVRQDGIDSIGEGTKEPSSSENDSLGPAECSFKKPAKIN
VLGQSVCYNDHTEALNPEKSEITQSVTDRMHLRKEPADTEESTLQNLLPQLSHKTSDLVE
NVECSLDIDHNLGSSVDRMTDDASMPDTVDKRTSFIRCDTLSMSLPKQIKLTGSQHPPTA
NSLHVSLQKVEDREAKIKDESSPKIVPKKPQRHSLPAAGVLKKAASAELIEKSSYASSED
KSSSVLEGSHFTRTQAREQGALSSCDIPKRSSEKPVWKLPHPILPFSGNSESLKTASIAP
SFSHVSAVTKPRAKSLSSVDMERTDKPCKDPQKKNSLKKFLNVKLSVCLMKSDFQKFLSK
GSQSMDSSTANLSTGEGYGNGNNRHVSSVGSERKAKSAKARSVEISSPALQKKRQRNRSQ
PEMRSNQRLESSDGHSLPGDNLSQMHLNSVTSNCAPEYENLRHYEEIPEYENLPFAMGAG
KNLSLEWQNSSHVEDPSPSLYEMEEPFQAASRRVRHGRNHQFNSSGLRSLEEHHDHPGMV
IGDLQSDEEDIMNSSDEDDDTNSDSSKGEPDSQDQEKKGKAAGKKTKVYHIAKEIMSSEK
VFVDVLKLLHIDFRDAVAHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLRELEERLS
HWLEHQRIADIFVKKGPYLKMYSTYIKEFDKNIALLDEQCKKNAGFASVVKDFEMSPRCA
SLALKHYLLKPVQRIPQYRLLLTDYLKNLLEESADYRDTQDALAVVIEVANHANDIMKQG
DNFQKLMQIQYSLNGHHEIVQPGRIFLKEGTLMKLSRKVMQPRMFFLFNDALLYTTPVQS
GMYKLNNMLSLAGMKVKKPSQEAYQNELNIESVERSFILSASSATERDEWLEAISRSIED
YTKKRITFNPSKSLEEADTEKQEETSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHC
RACGKIVCQACSSNKHGLDYMKNQPARVCDHCFRELQKQDNQCSSKTGSPVNHKSPSSAL
STVLHSIPSGRKQKKIPAALKEVSANTEDSTMSGYLHRSKGSKKPWKHLWFVIKNKVLYT
YAASEDVAALESQPLLGFTVSEVRDENSESRVFHLLHKNTLFYIFKADDPHSAQKWIEAF
QEGTVL
Download sequence
Identical sequences G1NFW6
ENSMGAP00000011933 ENSMGAP00000011933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]