SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NGZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NGZ6
Domain Number 1 Region: 869-1142
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.63e-65
Family Protein kinases, catalytic subunit 0.0000107
Further Details:      
 
Domain Number 2 Region: 563-845
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-45
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 430-541,571-597
Classification Level Classification E-value
Superfamily SH2 domain 1.99e-16
Family SH2 domain 0.0036
Further Details:      
 
Domain Number 4 Region: 148-280
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000596
Family Second domain of FERM 0.0062
Further Details:      
 
Domain Number 5 Region: 361-421
Classification Level Classification E-value
Superfamily PH domain-like 0.000000135
Family Third domain of FERM 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NGZ6
Sequence length 1151
Comment (tr|G1NGZ6|G1NGZ6_MELGA) Tyrosine-protein kinase {ECO:0000256|PIRNR:PIRNR000636, ECO:0000256|RuleBase:RU362096} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=JAK1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MQYLNVKEDCKAMAFCAKMRSTKKSEVNLEAQHQGLEILFYLQDKSPISYTSGEFTSEEL
CIEAAQKCSISPLCHNLFALFDENRKLWYAPNQVFKIDEKTSHRLYYRMRYYFTNWHGTS
ENEPSVWRHTPKKAKNSYDKKLAPEGTPILDANSLEYIFAQGQYDLVKGLAPIRDPKNDQ
EVHEIENECLGMAVLAISHYAIKKNVKLPELPKDISYKHYIPETLNKTIRQRNFLTRIRI
NNVFKHFLKEFNNKTICDSSVSPRDLKVKYLSTMETLTKYYGAEIFETSSLLISSESEIN
RFNCGDGEIIPLYEVIVTGNNGIQWRLKPNSVQTEKEKKKKSDGKIKKDEDRYKTRDLWN
NFSYFPEITHIVIKESTVSINKQDNKKMELKLSSHDEALSFASLIDGYFRLTADAHHYLC
TDVAPPLIEHNIKNGCHGPICTEYAINKLRQEGNEAGMYVLRWSCTNFNHILMTVTCLEG
PEMINNSVQYKNFQIEVKKGGYFLHGSNRSFASLKELMDHLKGQILRTDNISFTLKRCCQ
PKPREISNLLVATKKAQECQPAYHLGQLSFHRIRKEEIMQGEHLGRGTRTQIYSGILNYK
DDENEGYQNEKEIKVLLKVLDPSHRDISLAFFEAASMMRQVSHKHIVFLHGVCVRDLENI
MVEEFVEFGPLDLFMHRKSELLTTPWKFNVAKQLASALSYLEDKDLVHGNVCTKNILLAR
EGIDTEYGPFIKLSDPGIPITVLSRQECVERIPWIAPECVEDSKNLSIAADKWSFGTTLW
EICYNGETPLKDKTLAEKERFYEGHFMLITPSCKELADLMKQCMNYDPHQRPFFRAIMRD
INKLEEQNPDIVSEKKPVTEVDPTLFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQ
VAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSL
KEYLPRNKNKINLKQLLRYAVQICKGMDYLGSRQYVHRDLAANVLVESENRVKIGDFGLT
KAIETDKEYYTVKDDLDSPVFWYAPECLIQSKFYIASDVWSFGVTLYELLTYCDSESSPM
TEFLKMIGPTQGQMTVARLVRVLQEEKRLPRPPNCPEEIDQLMRKCWIFKHDKRTTFHNL
IQGFETIMSKM
Download sequence
Identical sequences G1NGZ6
ENSMGAP00000012412 ENSMGAP00000012412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]