SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1NH64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NH64
Domain Number 1 Region: 94-225
Classification Level Classification E-value
Superfamily EF-hand 2.59e-24
Family Calmodulin-like 0.023
Further Details:      
 
Domain Number 2 Region: 21-127
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000215
Family Calmodulin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NH64
Sequence length 258
Comment (tr|G1NH64|G1NH64_MELGA) Calbindin 1 {ECO:0000313|Ensembl:ENSMGAP00000012493} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CALB1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
LKSGESLEGAVTASVTLFVVGNGYMDGKELQNFIQELQQARKKAGLDLTPEMKAFVDQYG
KATDGKIGIVELAQVLPTEENFLLFFRCQQLKSSEDFMQTWRKYDSDHSGFIDSEELKSF
LKDLLQKANKQIEDSKLTEYTEIMLRMFDANNDGKLELTELASLQRLLPVQENFLIKFQG
VKMCAKEFNKAFEMYDQDGNGYIDENELDALLKDLCEKNKKELDINNLATYKKSIMALSD
GGKLYRAELALILCAEEN
Download sequence
Identical sequences G1NH64
ENSMGAP00000012493 ENSMGAP00000012493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]