SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NH77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NH77
Domain Number 1 Region: 246-307
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-22
Family SH3-domain 0.00055
Further Details:      
 
Domain Number 2 Region: 67-121
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.69e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NH77
Sequence length 333
Comment (tr|G1NH77|G1NH77_MELGA) SH3 and cysteine rich domain {ECO:0000313|Ensembl:ENSMGAP00000012510} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=STAC OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
QLQKLKRSLSFKTKSLRSKSADNFFQRTNSDVKLQVDLMPEVSTSTGQLPSSESQASSPT
RTQQLSENNKTHIFQEHIFKKPTFCDVCNHMIVGTNAKHGLRCKACKMSIHHKCADSIGQ
QRCMGKLPKGFRRYYSSPLLIHEQFGCIKEVMPIACGNKVDPVYETLRFGTSLAQKTKKG
SSGSGSDSPNRNSTADLAEVPEEADSSLDLSRKRSNSVFTYSENGTEHFGEEPKSIHSPG
PFYKSTLQMNTYVALYKFVPQENEDLEMRPGDMITLLEDSNEDWWKGKIDDRTGFFPANF
VQRVQHDEKIYRCIRTFIGCKEQGQITLKENQV
Download sequence
Identical sequences G1NH77
ENSMGAP00000012510 ENSMGAP00000012510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]