SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NHQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NHQ1
Domain Number 1 Region: 12-208
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-51
Family DBL homology domain (DH-domain) 0.0000144
Further Details:      
 
Domain Number 2 Region: 206-324
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-34
Family Pleckstrin-homology domain (PH domain) 0.00058
Further Details:      
 
Domain Number 3 Region: 410-474
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000588
Family SH3-domain 0.0000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NHQ1
Sequence length 486
Comment (tr|G1NHQ1|G1NHQ1_MELGA) Kalirin RhoGEF kinase {ECO:0000313|Ensembl:ENSMGAP00000012724} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=KALRN OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MAPSTPPRNLEEEQKAKAMRGRMFVLNELVQTEKDYVKDLGTVVEGFMKRIEEKGVSEDM
KGKDKIVFGNIHQIYDWHKDFFLAELEKCLQEHDRLAQLFIKHERRLHMYVVYCQNKPRS
EYIVAEYEAYFEEVQQEINQRLTISDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSEIE
KAVELMCLVPKRCNDMMNLGRLQGFEGKLTAQGKLLQQDTFYVTEQDSGVQSRPKERRVF
LFEQIVIFSELLRKGSLTPGYMFKKSIKMNYLVIEENVDNDPCRFALMSRETSERVILQA
ANPEIQQAWVQDINQVLDTQRDFLNALQSPIEYQRKESSTAVLRPQAGRVAQPNSRPYSS
VPVGSEKPLKATSRNPSLPPLKISTSNGSTGYEQPGDKYEQSKTDLGGCNGTSSMVVIKD
YYALKEDEICVNQGEVVQILAINQQNMFLVYQPANDHSPAAEGWIPGNILAPLTKSTADN
SDGSIK
Download sequence
Identical sequences G1NHQ1
ENSMGAP00000012724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]