SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NHR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NHR0
Domain Number 1 Region: 209-462
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.29e-54
Family Bacterial dinuclear zinc exopeptidases 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NHR0
Sequence length 469
Comment (tr|G1NHR0|G1NHR0_MELGA) Carboxypeptidase Q {ECO:0000313|Ensembl:ENSMGAP00000012733} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CPQ OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MKYLFLIFFMNLLPQYAGKSLSRDGNYPKTFEDIRNEIAGYYDIAKAIIDLAVYGKAQNR
SYERLAVFADTIGPRLSGSKNLDAAIKYMYSALQKDGLENVHLEPVKVPHWERGEEFAMM
LEPRNHSIAILGLGSSVATPPEGITAEVIVVASFDELHRRAQEAKGKIVVYNQPFITYGE
TVRYRSLGAVEAAKVGAVASLIRSVASFSIDSPHTGWQNYQSGIPQIPTACISVEDAEMM
SRMSFRGTKIVVYLKMGARTYPDSASFNTVAEIVGSKYPEQIVLVSGHLDSWDVGQGAMD
DGGGAFISWEALTLIKDLGLRPKRTLRLVLWTGEEQGGIGAEQYYQLHKENISNFDIVME
SDEGTFKPSGLAFTGNAKAHDIVREIMALLLPINITEVYDAADGTDINFWMRDGVPGASL
RDDLSKYFWFHHSQGDTMTVQDPNQMNLCAAVWTVVSYIIADMEEMLPR
Download sequence
Identical sequences G1NHR0
ENSMGAP00000012733 XP_010707460.1.16129 XP_010707461.1.16129 XP_010707462.1.16129 XP_010707463.1.16129 XP_019469705.1.16129 ENSMGAP00000012733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]