SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NJ51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NJ51
Domain Number 1 Region: 106-317
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-61
Family DBL homology domain (DH-domain) 0.0000255
Further Details:      
 
Domain Number 2 Region: 302-447
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-24
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NJ51
Sequence length 1408
Comment (tr|G1NJ51|G1NJ51_MELGA) Pleckstrin homology and RhoGEF domain containing G1 {ECO:0000313|Ensembl:ENSMGAP00000013330} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PLEKHG1 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MDLSDSDRPVSFSSTSSSASSRDSHCSFGSRMTLVSNSHLGLFNQEKETGAIKLELVPAR
RFSSNKPRKNTPAEHEDPEESLEKKLSTPRKAEPKGAGKNCAMSLVTEPTSPKLLYVDRV
VQEILETERMYVQDLKSIVKDYLDCITDQSKLPLGTEERSALFGNIRDIYHFNSELLQDL
ENCENDPVAIADCFVSKSEDFHIYTQYCTNYPRSVAVLTECMRNKTLAKFFRERQEALQH
SLPLGSYLLKPVQRILKYHLLLHEIENHLDKDTEGYDVVLDAIDTMQRVAWHINDMKRKH
EHAIRLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKKRDEM
FAYKAHILCGNLMLVEVIPKEPLSFSVFHYKNPKMQHTVQVCKIHSKNKRLWILHLKRLI
LENHPAKIPAKAKQAILEMDAIHHPGFHYSPEGETKSSYQPKEGTTQQRVRRKSEPSSRV
HKVLKSNDISPDMQKNSRKKGSLESTRQSQSPRQFNTPQNSSLIMNMLGGTTSVRNIWTD
HQIRQALFPSRRPPYENEDDDDDYQMFMPSMSTSNTGSAVSGERRGHSDRPCSWHLGVVH
QNETPSSNRHKIVRRASSAGESNTCPTITRCKISERSSRRDVKRTEVNSMNAYPESSEEL
TTDDIEHVYDNISYEDLKLMGLTRREETHPGPQRSARDSLYEEENKSRLNSASKKRTANQ
SRASLHASRDEILLGREAPASSLDELRIVEDNIYDTIVLPETPLLKFKHDPLKCSIKRSF
LGLEKDVSCSDNLQQFVSEESLQFSEDESPYHRLPIDNDYLSLVDSSSNSDSLSHKSAAD
KLSEEVDEIWNDLENYIKKNQEKTRDRHLAAFPVCKDDIQERLHAGSTPELSKDVEYSLS
TLSLPETPIFPKTVKPRAATISEASLRLEDTMACKESSLASLNRSSFSGEVPFVDSPYES
ANSILSSAHTECMENDLAIVDKTKNRVFMMARQYSQKIKKANQLLKVKTPEQEQPASRQQ
KLKHKDLAAILEEKKQGGPAIGARIAEYSQLYDQIVFRDSSPKVQKEAWASPQEPSTVRF
STPLASTLPCAQVTGECSRAEDWLLHSTYSNGELADFSPWSESQDSKSKSSYAEAVTKSN
PRQLPSACSVPSLQISNRLHVPAQRWSAIISQPNKENLHQDHIYNSLGRRVSSIKPQAYS
RSQSSSSIVVNRSGESIVYPNETDKKTLHSDRNFHLNGHQALSIASACTGPDMRKQVPEN
YSDMILQDSQKVLRVNRPSPLTAQMATQNYFSNFKDTEEGEGDDDDYVEIRSEDEGSDLE
ASQNQTRKLDPKLHNTDTDPSETFCGKTVSCTPAKPTGSKHTLTPYLTAYSDSDKLNDYL
WRVPSPNQQNIVQSLREKFQCLSSSSFA
Download sequence
Identical sequences G1NJ51
ENSMGAP00000013330 ENSMGAP00000013330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]