SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NJG0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NJG0
Domain Number 1 Region: 1303-1465
Classification Level Classification E-value
Superfamily PH domain-like 8e-70
Family Pleckstrin-homology domain (PH domain) 0.00000472
Further Details:      
 
Domain Number 2 Region: 1093-1306
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.06e-52
Family DBL homology domain (DH-domain) 0.0000000961
Further Details:      
 
Domain Number 3 Region: 508-624
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-20
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 4 Region: 874-983
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000025
Family PDZ domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NJG0
Sequence length 1706
Comment (tr|G1NJG0|G1NJG0_MELGA) T-cell lymphoma invasion and metastasis 2 {ECO:0000313|Ensembl:ENSMGAP00000013467} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=TIAM2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
KMGNSESQYSLQGSKNHATASTGSKQKPCSLKIRSIHAKDEKSCSLHGWGHTNSGSNYKS
RSLARSCLSHFKSSQPYSARLGDTVVKASKSNVLAKHRTHTSGDYCPGNNAVFLPDNGFH
YIGLQAGSNHAAPRECNGHILKCYGKNESLASASPSEDRRSPKVLIKTLGKLDGCLRVEF
HNSSNSKVPAEESSGPVQLLRYSPTLESKSNNLLDVRRNSSADCSSNHRLSPTDSRLRSS
KGSSLSSESSWYDSLWGNAGDINELDGPYLTRSTPDTSIHASFPPSDKKSFNQSSSLSSL
RDLYKDTNLESTPPPVIRLSDEYIDTHGSLSNRVSFASDIDVPSRVEQGSPAHYSSYTLP
CRKSKPLTEDASKKDTLKSRMRRISDWTGSLSRKKRKLQEPKCKDGGEYFDSRMDNFSTD
MLAPSQQPTLLWSPSSSHILSQRSESTNAVSSDALRQNIYENFMRELEMSRTNLENTETS
SETEDSSSESLSSLEQLDLLYEKEQGVVRKAGWLFFKPLVTLQKEKKLELVTRRKWKQYW
VTLKGCTLLFYETYGRNSMEQNSLPRYALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYL
FQATSQTDLENWVTAIHSACASLFAKKLGKEDTVRLLKNQTKSLFQKIDMDSKMKKMAEL
QLSIVSDPKNRKAIENQIQQWEQNLEKFNMDLFRMRCYLASLQGGELPNPKSLLAAASRP
SKLALGRLGIFSVSSFHALICSRDEAALRKRTLSLSQRVRNKKGLFSSLKGLDTLARKGK
EKRPSITQQVDEFLNVYCSVPDSIQKENAWETQTYVHFCDGQGVALTLKPEHRVEDVLSL
ACKMKQLEPRNYGLQLRRLVDENTEYCAPEPYEYIVDQVYDEIEICPLNVHHIHLTKTEN
ITDFGFAVTAQVDENQHLTHIFVSDVLPDGLAYKEGLRVGNEILSINGEPVSDLVLRQME
LLFSERSVMLTLRMSHCGSQQPLCASWSSDGDISRDPKSLLPPPNQSQLLEEFLDNFRKN
TANDADFDNVPDVTSSLKRSSTDGTLDQVPQREKTDPPFRSAEQISALCRNFQEVQTSSM
EGQKDNQDLPPRPLARHLSDADRLRKVIQELMDTEKSYVKDLSCLFELYLEPLQNETFLT
QDEMESLFGSLPEMLDFQKVFLETLEDGISSSSDFNTLETPSQFRKLLFSLGGSFLYYAD
HFKLYSGFCANHIKVQKVLERAKTDSAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYP
LLLKELVSLTDNESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVADQSGTEK
EVTELSMGELLMHSTVSWLNPFPSLGKARKDLELTVFVFKRAVILVYKENYKLKKKMPTN
ARAAHNYGDLDPFKFRWLIPLSALQVRLGNSAGTENSCIWELIHTKSELEGRPETIFQLC
SSDCENKTNIVKVIRSILRENFRRHIKCELPLEKTCKDRLIPLKNRVPATAKLASTRSLK
VLKNSPSSEWNGDQGKGTFQDSDECSLSSSTQSSSCNTTESIQEPKTSSPDQHVQSCASD
FSNALVKESDILSDDDDDDYQNLKKSSPTKDIEIQFQRLKISEEPNTDSERDQAAEKEEG
DGLKLREHPKLIRGHFCPVKRKVNSTKRNRGTLMAMQERHQSLDSHSDAANLDLNSILER
EFSVQSLTSVVNEDCFYEAVERHGKS
Download sequence
Identical sequences G1NJG0
ENSMGAP00000013467 ENSMGAP00000013467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]