SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NJM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NJM8
Domain Number 1 Region: 12-208
Classification Level Classification E-value
Superfamily E set domains 2.66e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NJM8
Sequence length 339
Comment (tr|G1NJM8|G1NJM8_MELGA) Potassium voltage-gated channel subfamily J member 3 {ECO:0000313|Ensembl:ENSMGAP00000013560} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=KCNJ3 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
GIILFLFQSILGSIVDAFLIGCMFIKMSQPKKRAETLMFSEHAAISMRDGKLTLMFRVGN
LRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAK
SPFYDLSQRSMQTEQFEIVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGF
FKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPLIAPAVSNSKERNNSVECLDGLDEVGI
KLPSKLQKITGRDDFPKKLLRMSSTTSEKAYSMGDLPMKLQRISSVPGNSEEKLVSKATK
MMSDPMSQSVADLPPKLQKLSGGGRMEGNLPPKLRKMNS
Download sequence
Identical sequences G1NJM8
ENSMGAP00000013560 ENSMGAP00000013560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]