SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NJR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NJR1
Domain Number 1 Region: 176-502
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.3e-80
Family Pancreatic carboxypeptidases 0.00000166
Further Details:      
 
Domain Number 2 Region: 38-160
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.14e-32
Family Frizzled cysteine-rich domain 0.00052
Further Details:      
 
Domain Number 3 Region: 502-580
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 6.87e-19
Family Carboxypeptidase regulatory domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NJR1
Sequence length 647
Comment (tr|G1NJR1|G1NJR1_MELGA) Carboxypeptidase Z {ECO:0000313|Ensembl:ENSMGAP00000013596} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CPZ OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MVPSLLLLLTGLFRATEPAPRCETGQETLGQCQTAQKAKCVDISLSSCTDVTYTQTMYPN
FLDQKSREVIEYSSEYILISVLHNLLQGECNPDLRLLGCSVLAPQCEKDKVIKPCRHVCE
NLKKNCLSAFDAIDMAWPYFLDCDRFFAGEEEGCFDPLAKLRGEVVVEEDLPSDLPATFI
QFKHHSYSQMVSTLKKTASRCSHIATTYSIGRSFEGKDLFVIEFSTKPGHHELLKPEFKY
IGNMHGNEVVGKELLIYLAQYLCSEYLLGNPRIQTLINNTRIHLLPSLNPDGYELAAEEG
AGYNGWVIGRQTAQNLDLNRNFPDLTSEAYRRAGIRGARLDHIPIPQSYWWGKVAPETKA
VMKWMRSIPFVLSASLHGGELVVTYPYDYSRHPMEEKEFSPTPDEKMFKMLAKAYADAHP
VISDRSEHRCGGNFVKRGGIINGAEWYSFTGGMADFNYLHTNCFEVTVEVGCEKFPLEEE
LFTIWHENRDALLNYMEMVHRGIKGIVSDKFGNPIKNARISVRGIQHDITTAADGDYWRL
LPPGTYVITAQAMGYTRVMKRVTLPIKMKRAGRVDFVLRPIETWPNKLLRRPMEGMNDQY
DPLELFDPHAQHAQARGGSQQVREKPWWWSYFSSLGLHKPLWLLKQH
Download sequence
Identical sequences G1NJR1
ENSMGAP00000013596 ENSMGAP00000013596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]