SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NKT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NKT5
Domain Number 1 Region: 304-519
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.77e-61
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 502-635
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-33
Family Pleckstrin-homology domain (PH domain) 0.0023
Further Details:      
 
Domain Number 3 Region: 688-850
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-22
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NKT5
Sequence length 877
Comment (tr|G1NKT5|G1NKT5_MELGA) FYVE, RhoGEF and PH domain containing 4 {ECO:0000313|Ensembl:ENSMGAP00000014070} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=FGD4 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
KSFNVYKTNNFHTRTHPKVCSLCEYISKYFSGNSICPKSLILSRSCPASATTRLVEQNVH
NEAAQGINGSVPVKQSPRSASNPKPQVPPKPLHLQKLSPVTYQTSRHKALSSSKPRMEED
TPTPVSSVTKEKSNKVSDLIHRFEGCRYVIPFSPIDLKKDSSALNVSKSQGRYGSTPPPQ
PKLPSQHPLLKQGNSNTDKTQVAQTHTANGVVTQDQVDREDRRILDRGSTVSTLVPDNSI
NSSLINGERVSTSRDSLETTTSYEGSVLNSCYRTPSSDTLLPSDNEINTNVEEELNEEMI
KQDQPAETKETDEQKRHKIASELLQTEKAYVSRLGLLDQVFYSRLLEEANRGSFPAEVIN
KIFSNISSINAFHSKFLLPELEKRMQEWTTTPRIGDILQKLAPFLKMYGEYVKNFDNAME
LVKTWTERSPQFKFIIQEIQKEKVCGSLTLQHHMLEPVQRIPRYEMLLKDYLRKLPQDSL
DWKDAEKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQILK
LAARNTSAQERHLFLFNNMLLYCVPKFSLVGSKFSVRTRVGIDGMKIIETHNEEYPHTFQ
VSGKERTLELQASSEQDKEEWIKALQNTIEAFQQRNETFRNAIAKEEYEDMPVEVSNAEL
GKRAPRWIRDNEVTMCMKCKEPFNALTRRRHHCRACGHVVCWKCSDYKAHLEYDGNKLNK
VCKDCYHVIIGCTDSEEKKKKGILEIESAEVSGNSVICSFLQYMEKSKPWQKAWCVIPKQ
EAVVLYMYGAPQDVKALATIPLLGYTVDDTPRSADLPHSFKLTQSKSVHSFAADNEELKQ
KWLKVIHLAVKGETSECQNELQVNLEEQPESSKTSEC
Download sequence
Identical sequences G1NKT5
ENSMGAP00000014070 ENSMGAP00000014070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]