SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NLD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NLD4
Domain Number 1 Region: 1229-1515
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.75e-54
Family Tandem AAA-ATPase domain 0.00017
Further Details:      
 
Domain Number 2 Region: 1524-1733
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.37e-46
Family Tandem AAA-ATPase domain 0.00085
Further Details:      
 
Domain Number 3 Region: 1018-1191
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 7.46e-45
Family Sec63 N-terminal domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1852-2046
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 1.15e-44
Family Sec63 N-terminal domain 0.0000787
Further Details:      
 
Domain Number 5 Region: 434-671
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.51e-42
Family Tandem AAA-ATPase domain 0.00039
Further Details:      
 
Domain Number 6 Region: 681-896
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.99e-40
Family Tandem AAA-ATPase domain 0.00049
Further Details:      
 
Domain Number 7 Region: 2083-2191
Classification Level Classification E-value
Superfamily E set domains 5.32e-24
Family Sec63 C-terminal domain-like 0.00063
Further Details:      
 
Domain Number 8 Region: 896-1001
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000326
Family Forkhead DNA-binding domain 0.075
Further Details:      
 
Domain Number 9 Region: 1733-1835
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000087
Family Z-DNA binding domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NLD4
Sequence length 2213
Comment (tr|G1NLD4|G1NLD4_MELGA) Activating signal cointegrator 1 complex subunit 3 {ECO:0000313|Ensembl:ENSMGAP00000014323} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=ASCC3 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MALPRLTGALRSFSNVTRHDDYSEELADLTKKRTKQQELLLKSDLTWKKIIKFVDDNLDK
KEYQTVNGDLKTILQAAKQIVGAENGQEAIESGAVFLFKTFHRKECVGHDETKAIKQMFG
PFPSSSATAACNATCRIASHFTEEQLTALIQMAEEQNGDNTVFFGKNIVFSFDMHDLDHS
EELPVNGEADAQRIISLDYKKFLNNQLDHLKNCCNEKSDLKSLGKVDDSFLWSEVGKYLN
ESQGGTPGGPTTEDLCCTLYEMLASPKSGDELQNELFELLGPEGFELIEKLLQNRSVIVE
KSLTCQNDNKFQTLQEQCKKFISENAKPNYGCQVTIQSEQEKLLMKQYRREEKRNARREK
QAGEDGEVSGEGLACFDPRELRMQRELALLNARSMPILGRQREVDFERIHYPHVYDSRAE
AMKTSAFIGGAKVFLPESVQRENNKMYEEVKIPHSEPMPIGIEEKIVYIKDLDEIGQLAF
KGMKRLNRIQSIVFETAYNTNENMLICAPTGAGKTNIAMLTILHEIRQHVQHGVIKKDEF
KIVYVAPMKALAAEMTNYFSKRLEPLGITVKELTGDMQLSKGEILRTQMLVTTPEKWDVV
TRKSVGDVALSQLVKLLILDEVHLLHEDRGPVLESIVARTLRQVESTQSMIRILGLSATL
PNYLDVATFLHVNPYIGLFYFDSRFRPVPLGQTFIGIKTTNKYVAENNLDNFCCFYSYVL
SSISFCLKVMVFVHARNATVRTAMALREKAKNNGHICHFLSPQGSDYRQAEKQVQRSRNK
QLRELFPDGFSIHHAGMLRQDRSLVENLFSNGHIKVLVCTATLAWGVNLPAHAVVIKGTQ
IYAAKRGSFVDLGILDVMQIFGRAGRPQFDKFGEGIIITTHDKLSHYLTLLTQQNPIESQ
FLESLADNLNAEIALGTVTNVEEAVKWISYTYLYVRMRANPLVYGISHKAYQMDPGLEKH
REQLVIEVGRKLDRARMIRFEERTGFFSSTDLGRTASHYYIKYNTIETFNELFDAHKTEG
DILAIVSKAEEFEQIKVREEEIEELDTLLNDFCELPAPGGVENNYGKINILLQTYISRGE
MDSFSLISDSAYVAQNAARIVRALFEIALRKRWPAMTYRLLNLSKVIDKRLWGWVSPLRQ
FSVLPPSVLSKLEEKNLTIDKMKDMRKDEIGHMLHHVKIGLKVKQCVHQIPSIAMEVTIQ
PITRTVLRVRLNITPDFTWNDQVHGTVGEPWWIWVEDPTNDHIYHSEYFIVQKKQVITKE
PQLLVFTIPIFEPLPSQYYIRAVSDRWLGAEAVCIINFQHLILPERHPPHTELLDLQPLP
VTALGHPEYEVLYKFTHFNPIQTQIFHTLYHTDCNVLLGAPTGSGKTVAAELAIFRVFNK
YPTSKAVYIAPLKALVRERIEDWKVRIEEKLGKKVVELTGDVTPDMRAIAQADLIVTTPE
KWDGVSRSWQNRSYVQKVSILIIDEIHLLGDERGPVLEVIVSRTNFISSHTEKPVRVVGL
STALANARDLADWLNINQMGLFNFRPSVRPVPLEVHIQGFPGQHYCPRMARMNKPAFQAI
RSHSPAKPVLIFVSSRRQTRLTSLDLIAFLATEDDPKQWLKMDEREMNDIIGTVRDSNLK
LTLAFGIGMHHAGLHERDRKTVEELFVNCKIQVLIATSTLAWGVNFPAHLVIVKGTEYYD
GKTRRYVDYPITDVLQMMGRAGRPQFDDQGKAVILVHDIKKDFYKKFLYEPFPVESSLLD
VLADHLNAEIAAGTITSKQDAMDYITWTYFFRRLIMNPTYYNLDNVSHDTMNKYLSSLVE
KSLFDLECSYCIEIGEDNRSIEPLTYGRIASYYYLKHPTIGMFKDQLKPESTVEELLLIL
TNADEYTDLPVRHNEDQMNSELAKHLPIEVNPHSFDSSHTKTHLLLQAHFSHAMLPCPDY
ATDTKTVLDQAIRICQAMLDVTAHHGWLVAALNITNLVQMVVQGRWVHDSSLLTVPNIEV
QHLYLFQKWSQGKRKSLHGGYQGPIECLPELMAACEGKENVFASIVDNELQTAHISQAWN
FLSRLPILNVSLSIKGCWDDPAQPQNEVPVPSLTTDTRDDKRWIKLHADQEYVLQIHLQR
TQMGYQGKQDSKAVAPRFPKVKDEGWFLILGEVDKKELIALKRTGYVRNRNTVSVAFYTP
ETPGKCIYTLYVMSDSYLGMDQQYDIYLNIIPASTSAQATTEVSDAMSYLTLK
Download sequence
Identical sequences G1NLD4
ENSMGAP00000014323 ENSMGAP00000014323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]