SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NLE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NLE4
Domain Number 1 Region: 376-699
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-94
Family Protein kinases, catalytic subunit 0.0000000139
Further Details:      
 
Domain Number 2 Region: 2-99
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-22
Family PLC-like (P variant) 0.0000964
Further Details:      
 
Domain Number 3 Region: 201-265
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.43e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0005
Further Details:      
 
Domain Number 4 Region: 119-188
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.59e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NLE4
Sequence length 706
Comment (tr|G1NLE4|G1NLE4_MELGA) Protein kinase C {ECO:0000256|PIRNR:PIRNR000551, ECO:0000256|SAAS:SAAS00929532} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PRKCH OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
LLDPYVTVSVDQVRVGQTSTKQKTNKPTYNEEFSATVTDGHQIELSVFHDTPIGYDDFVA
NCTLHFQDLLRSAGPSDSFEGWVDLEPEGKVFVVITLTGSFTEGNTIMETRVFQTRNLTR
KRQRAMRRRVHQVNGHKFMATYLRQPTYCSHCKEFIWGVFGKQGYQCQVCTCVVHKRCHH
LIVTACTCQNNTNKNDLKEPQVTEQRFGINIPHKFSVHNYKVPTFCDHCGSLLWGIMRQG
LQCKICKMNVHIRCQANVAPNCGVNSAELAKTLACMGLQPGSISPNSECRRNVLWAKISP
GKEMSSTPKEDENKKQSPLITCKKGMLELMRLLKMQMNIASMNKLASRSSLRHQGKGSLK
DNNGVSENSASKLGIKDLTFLRVLGKGSFGKVMLAKMKESGQLYAVKVLKKDVILQDDDV
ECTMTEKRILSLARNHPFLTKLYCCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEDRAR
FYAAEIISALMFLHERGIIYRDLKLDNVLLDHEGHCKLADFGMCKEGIHDGITTATFCGT
PDYIAPEILQEMLYGPDVDWWAMGVLLYEMLCGHAPFEAENEDDLFEAILNDEVVYPSWL
QQDAVAILKAFMTKNPSMRLGSTALGGESAILRHPYFKELDWELLNQRQMEPPFRPRIKS
KDDVSNFDPDFIKEEPILTPIEEGILPMINQDEFRNFSFTSPELQQ
Download sequence
Identical sequences G1NLE4
ENSMGAP00000014334 ENSMGAP00000014334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]