SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NLG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NLG9
Domain Number 1 Region: 25-159
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-40
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NLG9
Sequence length 1102
Comment (tr|G1NLG9|G1NLG9_MELGA) Pleckstrin homology domain containing A5 {ECO:0000313|Ensembl:ENSMGAP00000014365} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PLEKHA5 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MTSEEKKERPVSVICEATNYNLTSDYAAHPMSPVGRTSRSSKKVHNFGKRSNSIKRNPNA
PVVRRGWLYKQDSTGMKLWKKRWFVLSDLCLFYYRDEKEEGILGSILLPSFQISVLSPED
HINRKYAFKAAHPNMRTYYFCTDTGKEMELWMKAMTDAALVQTEPVKRVEKFTTENTPPR
EANNISNHRVLIKPEAQNNQKNREVNKNEEKKALEAEKYGFQKVGQDKPLTKINSVKLNP
LGSEYRTLPITTVQAGHFRPVHLNGAENKAVGVVLADTGDGGQHNAVQSHMESERVMQRT
NSMLQLEQWIKIQRGKGQEEEARGIISYQTLPRNMPSHRPQALPRYPEGYRTLPRNSKAR
PESLCSMTPSAYDRAIGPMTRKRRSMRDDTMWQLYEWQQRQFYNKQTTLTRHSTLSSPKT
MMNISDQTMHSIPTSPSHGSIAGFQGYSPQRTYRSEVSSPVQRGDVTIDRRHRAHHTKHV
YMPDRRSMPAVLSLQPVSPQSLQGKTMKENEPLITMVHTMIENSALRPQLYQQLTQEECR
GTLYKYRTEELDIDAKLSRLCEQDKVVQALEEKLQQLHKEKYTLEQALLSASQEIEMNAD
NPAAIQNVVLQRDDLQNGLLGTCREVSRATAELERAWREYDKLEYDVTATRNHMQEQLDR
LGEIQTESAGIQRAQIQKELWRIQDVMEGLSKHKQQRSSSDAGIMGSRTFSAIKYKNEEE
EVVPPRPPLPRSYDFTEHPPIIPPLPSDSSSLLCYSRGPVHLPEEKKIHQVQGYQRNGSH
CGPDYRLYKSEPELTTVAEVDESNGEEKTEQMLESESAAKGSHFPVGVVPPRTKSPTPES
STIASYVTLRKNKKIDLRTERPRSAVEQLCLAESTRPRMTVEEQMERIKRHQQACLREKR
KGLNIIGVSDQSPSQSLSFVRDNPFKSAQNRKKDDTVSSHIKELESTTKDNNLKQNNESP
EEEVVQVKHDGEQEHNSGFTKELTKTDDFLSDTHVVSDSKEVNNEEKAEKEKNNKVEETH
DVSLQSVTTVGNHKPKTSSEESEAVSVQEQKGIIASFELAAQSSKGNQATAVKSLPSSPE
SSLSPASSTQPQLTEGSHFMCV
Download sequence
Identical sequences G1NLG9
ENSMGAP00000014365 ENSMGAP00000014365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]