SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NMI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NMI4
Domain Number 1 Region: 223-291
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.88e-21
Family Complement components 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NMI4
Sequence length 291
Comment (tr|G1NMI4|G1NMI4_MELGA) Uncharacterized protein {ECO:0000313|Ensembl:ENSMGAP00000014798} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=LOC100545094 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MLTTSNVSLVIEAAANSFCAVRAVDKSVLLLKTETELSAETIYNLHPIQDLQGYIFNGFE
LEDDPQDPCISPDNIFHKGLYYRPLTSGLGPDVYQFLRDMGMKFFTNSRIRQPVVCTSGT
VRPPSYFLNSGFTASTHHVKLSAEVAREERVKRHILETIREFFPETWIWNIVLINSTGKA
SVSYTIPDTVTEWKASAFCVEESAGFGISVPGMFSLPGDIMGTAMQNMHQLLLMPFGNGE
QNMVLFAPNIYVLDYLNKTRQLSEDVKSKTIGYLVSGYQKQLSYKHPDGSY
Download sequence
Identical sequences G1NMI4
ENSMGAP00000014798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]