SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NMR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NMR0
Domain Number 1 Region: 5-194,290-379
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.13e-44
Family Pancreatic carboxypeptidases 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NMR0
Sequence length 517
Comment (tr|G1NMR0|G1NMR0_MELGA) ATP/GTP binding protein like 5 {ECO:0000313|Ensembl:ENSMGAP00000014886} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=AGBL5 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
RGTTTYFAFCYPFSYTECQEMLAQLDSRFEECRHMAPSSPLDSVYYHRELLCHSLDKLRV
DLLTVTSCHGMQERREPRLDKLFPDTATPRPRCFTGKRVFFLSSRVHPGETPSSFVFNGF
LHFILREEDPRAQMLRRMFVFKLIPMLNPDGVVRGHYRTDSRGVNLNRQYLNPDAELHPA
VYGAKAVLLYHHVHSRVLPGSPDWRTYVSPLSTSVLSTRSSNHSVPEAALSELEKTNNFR
NASSTWSRGLSPSQEPQVDLIFPERRCEEEAGQPLPLPEAILPQHSGLAYYVDLHGHASK
RGCFMYGNNFSDENDQVENMLFPKLISLNSPHFDFTGCNFSEKNMYAKDKRDGQSKEGSG
RVAIYKALGIIHSYTLECNYNTGRSVNSIPLACHDNGRASPPPPPSFPSKYTVELFEQVG
RALAVAALDMAECNPWPRIVLSEHNCLSNLRAWMLKHVRGTRGNGACVRRRGGRSPPRAL
GSGLPASASESALSRVRSFSHGSQQDSPRVRASPSFP
Download sequence
Identical sequences G1NMR0
ENSMGAP00000014886 ENSMGAP00000014886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]