SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NMT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NMT5
Domain Number 1 Region: 419-614
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-57
Family Protein kinases, catalytic subunit 0.000000751
Further Details:      
 
Domain Number 2 Region: 858-999
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 3.14e-57
Family FAT domain of focal adhesion kinase 0.00000485
Further Details:      
 
Domain Number 3 Region: 139-258
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-39
Family Second domain of FERM 0.0000248
Further Details:      
 
Domain Number 4 Region: 38-138
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.51e-32
Family First domain of FERM 0.00035
Further Details:      
 
Domain Number 5 Region: 262-366
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-29
Family Third domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NMT5
Sequence length 1003
Comment (tr|G1NMT5|G1NMT5_MELGA) Protein tyrosine kinase 2 beta {ECO:0000313|Ensembl:ENSMGAP00000014917} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=PTK2B OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MSALPEPLGRPRSSSFRSLAGTLEANLGMGTLEEDREEMRILKVCFYSNSFNMGKNFKLV
KCPVTTEIREVIRSILVSGRIGPNIQLSECYGLRLKHVKSDEIHWLHPELTVGEVQEKYE
CLHLEAEWRYDLQIRYLPEDYMERFLEDRTTLLYFYQQLRSEYMQNYASKVSEGMALQLG
CLELRRFYKDMPQNALDKKSNFEFLEKEVGLDLFFPSQMQENLKPKQFRKMIQQTFQQYA
LLREEECILKFLHTLSTFANIDQESYRCELIQGWNITVDLVIGPKGIRQMTSKEAKPTCL
AEFKHIKSIKCSSVEDGQAVLQLGLSGTPQSLAIKTSSLAEAENMADLIDGYCRLQGGLD
TSLIVFPRREKEKRSSLPRIPIPHLEERHSAVSDSLSVDSEIYAEIPDETSRPRSGAQHY
GICREDITLGRILGEGFFGEVYEGTYTNPKGERVNVAVKTCKKDCSPENKDKFLSEAVLM
KKLDHPHIVKLIGIAEEEPTWIIMELYPYGELGQYLEQNKHCLTVPTLVLYALQISKALA
YLEAINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEEYYKASVTRLPIKWMSPESIN
FRRFTTASDVWMFGRQWDGDGMGPGHIWRQHHGAQGHILLCLGERLLEQNVCSSNSSIWD
ALLSLEASCTQDVNLLRATKSQQDSALLRAQSYFCLRAPRVAFVPGQGSLQSSPHPVVCN
ALPILLSMLVPEGLCASSPTLTSPAEYQSPASSLHTPPLHRHNVFKRHSMREEDFLRPSS
REEAQKLWEMERLKMRQVLDKQQKQMVEDYQWLRQEEKSLDPTVFMNNNTALLLPEKETD
YSGVHGPPQKPPRLGAQSIQPAPTANLDRTDDTVYSNVMDLVRAVLQLKNEISLLPPEGY
ILVVKNVGLSLRKLIGSVDEILPILPATSRTEIEGTQKLLNKDLAELINKMRLAQQNAVT
SLSEECKKQMLTASHTLAVDAKNLLDAVDQAKVQANLVKLCLE
Download sequence
Identical sequences G1NMT5
ENSMGAP00000014917 ENSMGAP00000014917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]