SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G1NNK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NNK4
Domain Number 1 Region: 14-167
Classification Level Classification E-value
Superfamily EF-hand 1.5e-39
Family Calmodulin-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NNK4
Sequence length 187
Comment (tr|G1NNK4|G1NNK4_MELGA) Guanylate cyclase activator 1C {ECO:0000313|Ensembl:ENSMGAP00000015231} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=GUCA1C OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
MGANESLPGDGPIPEMHHYYSKFMRECPSGQLSLHEFKKLLDLQGLDPQGDLYIKRVFDI
FDLNQDGFIDFLEFIAAINLVIRGKIDQKLKWYFKLYDADGNGCIDKKELLSIFAAIQAI
NGQTNMTAEEFTNMIFQKIDVNNDGELTLEEFITGVERDEDLMELITKSFDLSNVIKVIQ
NGRRHSI
Download sequence
Identical sequences G1NNK4
XP_010719666.1.16129 ENSMGAP00000015231 ENSMGAP00000015231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]