SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NPS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NPS3
Domain Number 1 Region: 597-786
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-53
Family DBL homology domain (DH-domain) 0.0000000152
Further Details:      
 
Domain Number 2 Region: 790-931
Classification Level Classification E-value
Superfamily PH domain-like 1.86e-38
Family Pleckstrin-homology domain (PH domain) 0.000000174
Further Details:      
 
Domain Number 3 Region: 297-426
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000518
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 4 Region: 1032-1086
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000321
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 5 Region: 464-553
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0000314
Family C-terminal domain of PLC-beta 0.0083
Further Details:      
 
Domain Number 6 Region: 39-197
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000471
Family CRAL/TRIO domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NPS3
Sequence length 1133
Comment (tr|G1NPS3|G1NPS3_MELGA) MCF.2 cell line derived transforming sequence like {ECO:0000313|Ensembl:ENSMGAP00000015746} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=MCF2L OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
TGSRKLSVCMQSLWLLSVTLNSSTDEIMHQDIIPLYAADIHDQLKKQFAYLSGGRGGDGC
PVITFPDYPAFSEIPEKEFQNVLTYLTSIPRLSLRDAGIGFILVIDRRQDKWTSVKASIL
RIAASFPGNLQLVLVLRPTGLFHRALSDIAFKFNKDEFKMKVPIIMLGSVSELQGYIDKT
QLTEDLGGTLDYCHNRWLSRRTAIEGFAQKVKQTAQILQSFGTELAETELPNDVQSTSSL
LAVHTEKKDKMKEDIRLAVEQGDDILGSITKPVTENPEYKLNQDQLDNQTTVESLRLLAQ
LHETESAFDEFWIKHQQKLEQCLHLRNFEQNFREVKAALDIVSERLSAFTDVGNSCSHVE
HILKDLVNFEEKSRETVAKARMLASEGDAFIQSNHYAVDSIIPKCSELHHLCDAFTTEME
RKRNVLNKSLELHGLLEKSMKWCDEGIYLLASQPVDKCQSQDGAESALQEIEKFLDTGAG
NKIKELKKVYREYAHILNEDLKEHIQKVFQKQESMEEMFQKRQISLKKLAAKQTRPVQPV
APRPEAFVKSPCTSPGLQRDCVSNTESGVLRKVNYRRGKSEMSELHQSRGGSTMDDEENL
AVLRQHVMNELIETERAYVEELLCVLEGYAAEMDNPLMAHLISPELQNKKDILFGNMEEI
YHFHNRIFLRELENYVEYPELVGRCFLDQMEDFQIYEKYCQNKPRSESLWRQFSDSVFFQ
ECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSKNCEGAEDLQEALNSILGILKAV
NDSMHQIAITGYDGNLNELGKLLMQGSFNVWTDHKKGHSKVKDLARFKPMQRHLFLHEKA
VLFCKKREENGEGYEKAPSYSYKHSLNMAAVGITENVKGDAKKFEIWYNAREEVYIIQAP
TPEVKATWVNEIRKVLTSQLQACREASQHRTLEHTQSLPLPASSLNSPSRNNIRNMKKMD
ERKADLTGLEGYVTTVASKYPEKGKGWAKTSHSLDASEENDGWSSAEEPLNSSDAEEEGG
GGGGGSEMKLTPGKYTVVTDYEKGVSEEFAVKGGDLVQLIREGEDGLWYVKNLTTGREGW
IPANNLLMLIGNSKSAQSLSSSESGTASSTLSTSSSCSDSCNASSTSFSDIKG
Download sequence
Identical sequences G1NPS3
ENSMGAP00000015746 ENSMGAP00000015746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]