SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NQ42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NQ42
Domain Number 1 Region: 74-376
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.25e-108
Family Pancreatic carboxypeptidases 0.00000166
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000213
Family Pancreatic carboxypeptidase, activation domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NQ42
Sequence length 377
Comment (tr|G1NQ42|G1NQ42_MELGA) Carboxypeptidase B2 {ECO:0000313|Ensembl:ENSMGAP00000015904} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=CPB2 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
ETLQVILWQPVVVENIQKDQEVHFYVNASSTNRIKAGLRQLTIPHKVLMGDVQGLIEKQT
LNDTVNPRSSSSYYENYHSMTEIYHWMEETVRVHSDLLEKIYIGSSYEKRPLYVLKLSKR
QENPKSAIWIDCGIHAREWISPAFCLWFIGHTIHLRERDRIMTTLLEHFDFYVMPVMNVD
GYEYTWSKPSNRLWRKSRSSHSNSGCIGTDMNRNFDAHWCGKGASPNECYETYCGPYPES
EPEVKAVARFIRDHKDIIKAYITMHSYSQMVLFPYSYTMDKSKDHDELESLAKKAANAIR
RTTKKIYKLGPGAQTIYLAPGGSDDWAYDLGIKYSFTIELRDTGTYGFLLPSAQIRPTCM
EALSAVKEIAQHVLQNL
Download sequence
Identical sequences G1NQ42
ENSMGAP00000015904 ENSMGAP00000015904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]