SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NQQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NQQ0
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.59e-23
Family Frizzled cysteine-rich domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NQQ0
Sequence length 448
Comment (tr|G1NQQ0|G1NQQ0_MELGA) Frizzled class receptor 4 {ECO:0000313|Ensembl:ENSMGAP00000016156} KW=Complete proteome; Reference proteome OX=9103 OS=Meleagris gallopavo (Wild turkey). GN=FZD4 OC=Phasianidae; Meleagridinae; Meleagris.
Sequence
CFSFLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPDSLNCSKFP
PQNDHNHMCMEGPGDEEVPLHSKTSLQPGEECHSMGSNSDQYIWVKRNLDCVLKCGYDAG
LYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAY
IVRLTVGRERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFL
AAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTG
FVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPAT
CVIACYFYEISNWAVFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSN
RLVNSGKVKREKRADGWVKPGKGNETVV
Download sequence
Identical sequences G1NQQ0
ENSMGAP00000016156 ENSMGAP00000016156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]