SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NSK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NSK7
Domain Number 1 Region: 405-417,448-644
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 2.48e-32
Family Cofactor-dependent phosphoglycerate mutase 0.026
Further Details:      
 
Domain Number 2 Region: 284-349
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000174
Family SH3-domain 0.00098
Further Details:      
 
Domain Number 3 Region: 21-72
Classification Level Classification E-value
Superfamily UBA-like 0.000000000197
Family UBA domain 0.00034
Further Details:      
 
Weak hits

Sequence:  G1NSK7
Domain Number - Region: 74-134
Classification Level Classification E-value
Superfamily LigT-like 0.00523
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NSK7
Sequence length 668
Comment (tr|G1NSK7|G1NSK7_MYOLU) Ubiquitin associated and SH3 domain containing A {ECO:0000313|Ensembl:ENSMLUP00000000120} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=UBASH3A OC=Vespertilionidae; Myotis.
Sequence
MAAGETQVYAKVNSKLKARSAASLLDPLLSLGFPAHTALKALAATGRKTAEEAADWLRCH
CNDPSLDDPIPQEYALFLCPTGSLLEKLQEFWRESRRQCTKNRAHEVFPHITLCDFFTCE
DQKVECLYEALKRAGDKVLGSFPPAVPLVLHSSVSYLGFFVNDSPADVIREFAMTFATEA
AILAGTQTESTKFLFLQMPQIPPKIHISTPTSLTRPYRICRYPTTSSKDCTVKPCTKQLH
LTLAHKFYPHHQRTLEQLARAVHPGHSCQWTAALYSRDMRFVHYQTLRALFQYKPQNVDE
LTLSPGEYIFVDPTQQEEASEGWAIGISQRTGCRGFLPENYTERASECDTWVKHRTYTFS
LALDPNPRKDGEANSRRNGELLPPPRPRSAGSLQALQAAIVRRSVLVVRHGERVDQIFGK
SWLQQCSTPDGKYYRPDLNFPCSLPQRSNGIKGFENDPPLSSCGIFQSRTAGEALLDSGI
RITSVFASPALRCVQTAKHILEELKLERKIKIRVEPGIFEWTKWETGKTTPALMTLEELK
EANFNVSTEYRPAFPIASLLPAESYDEYVHRCAVSVEQVVSSCPQDAGVILIVGHGSTLD
SCTRPLLRLPPRDCADFAQLVRKIPSLGMCFCEENKEEGKWALVAPPVKTLTHGSNSAFN
WRNWILGN
Download sequence
Identical sequences G1NSK7
ENSMLUP00000000120 ENSMLUP00000000120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]