SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NSL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NSL0
Domain Number 1 Region: 20-119
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 4.84e-28
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0034
Further Details:      
 
Domain Number 2 Region: 109-186
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.000000000000405
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NSL0
Sequence length 313
Comment (tr|G1NSL0|G1NSL0_MYOLU) Radial spoke head 1 homolog {ECO:0000313|Ensembl:ENSMLUP00000000123} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RSPH1 OC=Vespertilionidae; Myotis.
Sequence
MSDLGSEELEEEGETDLGEYEGERNEAGERHGHGRARLPNGDTYEGSYEHGKRHGQGIYK
FKNGARYTGEYVKNKKHGQGIFIYPDGSRYEGEWVDDLRQGHGVYYYVNNDTYTGEWFAH
QRHGQGTYFYAETGSKYVGTWVNGQQEGAAEIIHLNHRYQGKFANKNPMGPGKYVFDIGC
EQHGEYRVTDAERVEEEEEEESVITALPKWKALKITELALWTPTLAEEPPPVDVPGQEET
PAAEARGEPGEEAQPLADLSDGEADFMRPGEEDADTFREEGEYGREEFRFDNIDQQGNVG
FEEDDPRQSDPQD
Download sequence
Identical sequences G1NSL0
ENSMLUP00000000123 ENSMLUP00000000123 XP_006103955.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]