SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NTC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NTC6
Domain Number 1 Region: 19-114
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-23
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NTC6
Sequence length 691
Comment (tr|G1NTC6|G1NTC6_MYOLU) GRB2 associated binding protein 1 {ECO:0000313|Ensembl:ENSMLUP00000000416} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=GAB1 OC=Vespertilionidae; Myotis.
Sequence
LIWASVNSTGVVDKSMETKKTLYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRIID
LNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPTE
EDPVKPPGSSLQVDLPSAVITTPPSAQVDSSSGAQPPPYQLINLPPHLETVGIQEDPQDY
LLLINCQSKKPEPTRTHADSAKSTSSDTDCNDNVPAHKNPASSQSKHGVNGFFQQQIMYD
SPPPRAVSVSADSSLYNLPRSYSHDVLPKASPSSTEADGELYVFNTPSGTSSIETQMRHV
SISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETGSIT
RTASDTDSSYCVPTAGMPPSRSNTISTVDLNKLRKDASSQDCYDIPRTFPSDRSSSLEGF
HNHFKIKNVSTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTFDFS
SFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKAKPAPLEIKPLPEWE
ELPAPVRSPITRSFARNSSRFPMSPRPGSVHSTTSSSDSHDSEENYVPMNPNLSGEDSNL
FGSSSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKISGSGSNVADERVDYVVVD
QQKTLALKSTREAWTDGRQSTESDTPTKSVK
Download sequence
Identical sequences G1NTC6
ENSMLUP00000000416 ENSMLUP00000000416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]