SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NTG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NTG7
Domain Number 1 Region: 143-416
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.65e-58
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.043
Further Details:      
 
Domain Number 2 Region: 35-98
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.53e-19
Family PHD domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NTG7
Sequence length 1059
Comment (tr|G1NTG7|G1NTG7_MYOLU) PHD finger protein 8 {ECO:0000313|Ensembl:ENSMLUP00000000462} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PHF8 OC=Vespertilionidae; Myotis.
Sequence
CPVLVQEGLVLLPPTPRDAANLACHTTPQGQLKMATVPVYCLCRLPYDVTRFMIECDMCQ
DWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPSISLVKKRRVSSKGHDAHKGKPVKTGSP
TFIRELRSRTFDSSDEVILKPTGSQLTVEFLEENSFSVPILVLKKDGLGMTLPSPSFTVR
DVEHYVGSDKEIDVIDVARQADCKMKLGDFVKYYYSGKREKVLNVISLEFSDTRLSNLVE
TPKIVRKLSWVENLWPEECIFERPNVQKYCLMSVRDSYTDFHIDFGGTSVWYHVLKGEKI
FYLIRPTNANLTLFECWSSSSNQDEMFFGDQVEKCYKCSVKQGQTLFIPTGWIHAVLTPV
DCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFKFPNFETICWYVGKHILDIFRGLREN
RRHPASYLIHGGKALNLAFRAWTRKEALPEHEEEIPDTVRTVQLIKDLAREIRLVEDIFQ
QKVGNTSSIFGMQRIFPGGSIPLTRPGHPTSIAISRLSMPSKTDSKKKGLKPKELFKKAE
RKGKESSALGPAGQLSYNLMDIYNHQALKTGSSQKEKFNITGTCLNDSDDDSPDLDVDGN
EGPLALLMSNGSTKRVKSLSKSRRAKIARKADKARLMAEHMMDDEFDLDSDDELQIDERL
GKDKTTLIIRPKFPRKLPRAKPCSDPNRVREPGEVEFDIEEDYTTDEDMVEGVEGKLGNG
SGAGGILDLLKASRQVGGPDYAALTEAPASPSTQEAIQGMLCMANLQSSSSSPATSSLQA
WWTGGQDRSSTSSSSGLGTVSSSPVSQRTPGKRPIKRPAYWRTESEEEEENASLDEQDSL
GACFKDAEYIYPSLESDDDDPALKSRPKKKKNSDDAPWSPKARVTPTLPKQDRPVREGTR
VASIETGLAAAAAKLAQQELQKAQKKKCIKKKPLLKEVEQPRPQESNVSVAAPAPALPTA
PQLLTSSSPVPPPEPKQEALSGSLADHEYTARPNAFGMAQANRSTTPMAPGVFLTQRRPS
VGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNGKLLL
Download sequence
Identical sequences G1NTG7
ENSMLUP00000000462 ENSMLUP00000000462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]