SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NU57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1NU57
Domain Number - Region: 8-70
Classification Level Classification E-value
Superfamily GAT-like domain 0.0199
Family GAT domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NU57
Sequence length 154
Comment (tr|G1NU57|G1NU57_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000000739} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=CCDC42 OC=Vespertilionidae; Myotis.
Sequence
QFEEIHEVMARYKTLVSMHQDLMQSAQEGQEKIERAKARLARYMEEKDDEILQHNNELAR
LQMRFDRARSDVIIWESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKQLKETTFVSLE
DTHKQLDMVQQFIQDLSDIWAEVKKKDQTPQIRV
Download sequence
Identical sequences G1NU57
ENSMLUP00000000739 ENSMLUP00000000739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]