SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NUD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NUD9
Domain Number 1 Region: 124-422
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-90
Family Nuclear receptor ligand-binding domain 0.00000000169
Further Details:      
 
Domain Number 2 Region: 21-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-28
Family Nuclear receptor 0.00000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NUD9
Sequence length 427
Comment (tr|G1NUD9|G1NUD9_MYOLU) Vitamin D receptor {ECO:0000313|Ensembl:ENSMLUP00000000832} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=VDR OC=Vespertilionidae; Myotis.
Sequence
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPRLSEEQQRIITILLDAHHKTYDPTYADFSQFRPPVRGPEGGDSHLSKSSLRHMPSFSG
DSSSSCSDQYTGSPDLMEPTNFSNLDLSEENSDSSSVTLDLSHLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTAEDQIVLLKSSAIEVIMLRSNQSFTMDDMSWTCGAEDYKYRISDV
TKAGHSLDLIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS
Download sequence
Identical sequences G1NUD9
ENSMLUP00000000832 XP_006091535.1.53796 ENSMLUP00000000832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]