SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NUU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NUU3
Domain Number 1 Region: 478-756
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.61e-51
Family Extended AAA-ATPase domain 0.0044
Further Details:      
 
Domain Number 2 Region: 123-225
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000000000229
Family LON domain-like 0.0067
Further Details:      
 
Domain Number 3 Region: 762-826
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000193
Family ATP-dependent protease Lon (La), catalytic domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NUU3
Sequence length 834
Comment (tr|G1NUU3|G1NUU3_MYOLU) Serine protease 15 {ECO:0000256|HAMAP-Rule:MF_03120} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=LONP1 OC=Vespertilionidae; Myotis.
Sequence
MAAGTGYVRLWGAARCWALRRPLLAVAGGRVQSAAGAWLHRGLRACDTSPPWALWGRGPT
AAGQWRGLWEANSRGGGSGFSGGEDAPEGGVEDGAAGAGGSAGGGEGPVITALTPMTIPD
VFPHLPLIAVTRNPVFPRFIKIIEVKNKKLVELLRRKVRLAQPYAGVFLKRDDTNESDVV
ESLDEIYHTGTFVQIHEMQDLGDKLRMIVMGHRRIHISRQLEVEPEEAEAEKQKPRRKPK
RSKKEAEEDLGVRRQMEVVVEPNSGTPSEVLMVEVENVVHEDFQVTEEVKALTAEIVKTI
RDIIALNPLYRESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNIPKRLY
KALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKEDKDAIEEK
FRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSDENLDL
ARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARAL
NREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQ
GDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVIETIPEPLRDRMEMINVSG
YVAQEKLAIAERYLVPQARALCGLDESKAKLSSDVLTVLIKQYCRESGVRNLQKQVEKVL
RKSAYKIVSGQAELVEVTPENLQDFVGKPVFTVERMYEVTPPGVVMGLAWTAMGGSTLFV
ETSPRRPQEKNSKDKDGSLEVTGQLGEVMKESARIAYTFARAFLMRHDPTNEYL
Download sequence
Identical sequences G1NUU3
ENSMLUP00000001009 ENSMLUP00000001009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]