SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NV56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NV56
Domain Number 1 Region: 154-215
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000268
Family UBA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NV56
Sequence length 215
Comment (tr|G1NV56|G1NV56_MYOLU) UBA domain containing 2 {ECO:0000313|Ensembl:ENSMLUP00000001137} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=UBAC2 OC=Vespertilionidae; Myotis.
Sequence
LAPVFALFVPFYCSIPRVQVAHILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLISG
ICYNSKILQVHQVLYIPSWMAKFCSWTLEPIFSSSEPTTEARVGMGATVDIQRQQRMELL
DRQLMLSQFAQARRQRQQQGGMINWNRLFPPLRQRRNINYQEGRRAEQQASPPLEVSEEQ
VARLMEMGFSRGDALEALRASNNDLNVATNFLLQH
Download sequence
Identical sequences G1NV56
ENSMLUP00000001137 ENSMLUP00000001137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]