SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NVI5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1NVI5
Domain Number - Region: 36-72
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0373
Family TB module/8-cys domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NVI5
Sequence length 129
Comment (tr|G1NVI5|G1NVI5_MYOLU) TNF receptor superfamily member 12A {ECO:0000313|Ensembl:ENSMLUP00000001286} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=TNFRSF12A OC=Vespertilionidae; Myotis.
Sequence
MALAPLRPLPRLLVLGLGLALLSAAAGEPVSGTTPCSRGSSWSEDLDKCMNCESCPALPH
SDFCRGCAGAPSASFGLLWPILGGALSLALVLGLLSGFLVWRRCRRREKFTTPIEETGGE
GCPGAALIQ
Download sequence
Identical sequences G1NVI5
ENSMLUP00000001286 ENSMLUP00000001286 XP_006090530.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]