SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NVQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NVQ3
Domain Number 1 Region: 261-439
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000213
Further Details:      
 
Domain Number 2 Region: 1-161
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.37e-33
Family BAR domain 0.01
Further Details:      
 
Domain Number 3 Region: 135-236
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-16
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NVQ3
Sequence length 670
Comment (tr|G1NVQ3|G1NVQ3_MYOLU) Oligophrenin 1 {ECO:0000313|Ensembl:ENSMLUP00000001364} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=OPHN1 OC=Vespertilionidae; Myotis.
Sequence
ERKKKFEKDGERFYSLLDRHLHLSSKKKESQLQEADLQVDKERHIFFESSLDYVYQIQEV
QESKKFNIVEPVLAFLHSLFISNNLTVELTQDFLPYKQKLQLSLQNTRNHFSSTREEMEE
LKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGISWVKYYCQYEKETKTLTMTPMEQKPG
AKQGPLDLTLKYCVRRKTESIDKRFCFDIETNERPGTITLQALSEANRRLWMEAMDGKEP
IYHSPITKQEEMELNEVGFKFVRKCINVIETKGIKTEGLYRTVGSNIQVQKLLNAFFDPK
CPGDVDFHNSDWDIKTITSSLKFYLRNLSEPVMTYRLHKELVSAAKSDNLDYRLGAIHSL
VYKLPEKNREMLELLIRHLVNVCEHSKENFMTPSNMGVIFGPTLMRAQEDTVAAMMNIKF
QNIVVEILIEHFVKIYSGPPEESAAPPVPPPRVTARRHKPITISKRLLRERTLVYNTSSL
DESEDKIQHQTPNGTVINSIEIPKPPQYPNLPIQKSGEPDPGRKSPSRLASDGKLESCPE
VDVGKLVSRLQDGGGSKATNGPVSGSGPTKASSFHIKRPAPRPLVHHKEGDSDSFSKVWP
PGEKPTIIRPPVRPPDPFCRAATPQKTKPDIVVGNAGEIPSSVVASRTRFFETASRKIGS
SQGRLPGDES
Download sequence
Identical sequences G1NVQ3
ENSMLUP00000001364 ENSMLUP00000001364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]