SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NVU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NVU2
Domain Number 1 Region: 216-337
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.24e-33
Family cAMP-binding domain 0.000000447
Further Details:      
 
Domain Number 2 Region: 345-469
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.83e-32
Family cAMP-binding domain 0.000000495
Further Details:      
 
Domain Number 3 Region: 111-159
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 2.62e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NVU2
Sequence length 478
Comment (tr|G1NVU2|G1NVU2_MYOLU) Protein kinase cAMP-dependent type I regulatory subunit alpha {ECO:0000313|Ensembl:ENSMLUP00000001409} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PRKAR1A OC=Vespertilionidae; Myotis.
Sequence
AAAADPRGPPPPLGRETARISPRGPRVLPCRGGVDHLTSETPHVGWGWDRGRGVERREKR
RRRQGGEERKRKDRTGGEKEAPESRAEREPRAARTRTMASGTSAATEEERSLRECELYVQ
KHNIQALLKDSIVQLCTARPERPMAFLREYFERLEKEEAKQIQNLQKASTRGDSREDEIS
PPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDD
NERSDIFDAMFPLSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGEL
ALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWE
RLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDY
FGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences G1NVU2
ENSMLUP00000001409 ENSMLUP00000001409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]