SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NVZ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NVZ4
Domain Number 1 Region: 321-428
Classification Level Classification E-value
Superfamily SH2 domain 1.02e-31
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 26-134
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-31
Family SH2 domain 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NVZ4
Sequence length 433
Comment (tr|G1NVZ4|G1NVZ4_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000001469} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PIK3R3 OC=Vespertilionidae; Myotis.
Sequence
IIFIFLLALPPKPPKPMTSAVTNGMKDNSVSLQDAEWYWGDISREEVNDKLRDMPDGTFL
VRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELIHHYHHESLAQY
NPKLDVKLMYPVSKYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQE
IQMKRTAIEAFNETIKIFEEQCHTQEQYRKEYIERFRREGNEKEIERIMMNYDKLKSRLG
EIHDSKMRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNA
WLGIKNEDADETYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKK
GCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQHNDSLNVRL
AYPVHAQMPSFCR
Download sequence
Identical sequences G1NVZ4
ENSMLUP00000001469 ENSMLUP00000001469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]