SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NW81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NW81
Domain Number 1 Region: 268-392
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.72e-37
Family Translational machinery components 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NW81
Sequence length 392
Comment (tr|G1NW81|G1NW81_MYOLU) Mitochondrial ribosomal protein S9 {ECO:0000313|Ensembl:ENSMLUP00000001571} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=MRPS9 OC=Vespertilionidae; Myotis.
Sequence
MAASCVSCGAVVSQRLLLRPRVSLAPRQVLWKAAELQSVPGPQILRLKHVTVVTTKKNVK
ALRRETYTVDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRAR
PIMKHPEQIFPKQKATQWGEDGRPFHYLFYTGKQSYYSLMHDTYGKILDIEKHKNQLQAK
GLFSEKDKTTDLIGSRWLIKEELEEMLVEKLSDQDYAQFLRLMERLLQCGAAEEEFVQSF
RRSVTVQSKKQPIEPVQHDAQGMAFSTSEGRRKSAKAEAVVYEHGNGRIKINGIDYLLYF
PVLQDREQLMFPFHFLDRLGKHDVTCTVSGGGRSAQAGAIRLAMARALCSFVTEEEVEWM
RQAGLLTSDPRVRERKKPGQEGARRKFTWKKR
Download sequence
Identical sequences G1NW81
ENSMLUP00000001571 ENSMLUP00000001571 XP_006098412.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]