SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NWE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NWE3
Domain Number 1 Region: 102-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000364
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 2 Region: 4-146
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NWE3
Sequence length 304
Comment (tr|G1NWE3|G1NWE3_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000001646} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=LOC102441074 OC=Vespertilionidae; Myotis.
Sequence
DISECASQPCQHGGTCLEGVNQYTCICPPGRTGSRCQHQAQTAAPERQADDPAFSRAPRC
AQVERTRHCSCEAGFQLSGTAGGDSVCQDVNECELYGQEGRPRLCMHTCVNTPGSYRCAC
PSGYRTLPDRKSCEDIDECVSSQHLCPRGTTCINTGGGFQCVSPECPEGSGNVSYVKTSP
FQCERNPCPMDSRPCHHLPKTISFHYLSLPSNLTTPITLFRMAMASVPGRPGPNSLRFGI
VGGNSRGHFVMQRADRQTGELILVQPLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVS
PYDF
Download sequence
Identical sequences G1NWE3
ENSMLUP00000001646 ENSMLUP00000001646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]