SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NX35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NX35
Domain Number 1 Region: 654-745
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.84e-40
Family Small-conductance potassium channel 0.0000026
Further Details:      
 
Domain Number 2 Region: 523-694
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NX35
Sequence length 838
Comment (tr|G1NX35|G1NX35_MYOLU) Potassium calcium-activated channel subfamily N member 2 {ECO:0000313|Ensembl:ENSMLUP00000001918} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=KCNN2 OC=Vespertilionidae; Myotis.
Sequence
MPIVLVRPTNRTRRLDSTGAGMGPSSHQQQESPLPTITHCAGCTTAWSPCSFNSPDMETP
LQFQRGFFSEQPPPPRSSHLHCQQQQPSQDKPCPPFASLPHAHHHPHLAHQQPGSGGSSP
CLRCNSCASSGAPGAGAGAGDNLSLLLRTSSPGGAFRTRTSSPLSGSSCCCCSSRRGSQL
NVSELTPSSHASALRQQYAQQPASASLYHQCHSLQPAASPTGSLGSLGSGPPLSHHHHHP
HLAHHQHHQSQARRESNPFTEIAMSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPP
ASVGGGGGASSPSAVAAAASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGSGSGH
GSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYD
KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEI
LVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFT
DASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDV
TSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTK
AEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQ
LRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSI
HALPGLISQTIRQQQRDFIEAQMENYDKHVAYNAERSRSSSRRRRSSSTAPPTSSESS
Download sequence
Identical sequences G1NX35
XP_014317552.1.53796 ENSMLUP00000001918 ENSMLUP00000001918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]