SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NXV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NXV6
Domain Number 1 Region: 6-418
Classification Level Classification E-value
Superfamily Ras GEF 5.62e-99
Family Ras GEF 0.00028
Further Details:      
 
Domain Number 2 Region: 489-549
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.83e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00099
Further Details:      
 
Domain Number 3 Region: 423-486
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000018
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1NXV6
Sequence length 697
Comment (tr|G1NXV6|G1NXV6_MYOLU) RAS guanyl releasing protein 3 {ECO:0000313|Ensembl:ENSMLUP00000002222} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=RASGRP3 OC=Vespertilionidae; Myotis.
Sequence
TMGSSGLGKAATLDELLSTCIEMFADDNGELDNSYLPRIVLLMHRWYLSSTELAEKLLCE
CTYRNASGESCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVS
LIDISSIPSYDWMRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDY
QSYVIHGCLENNPTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKQKLLQL
KNFNTLMAVVGGLSHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCE
GFKIPILGVHLKDLIAVHVIFPDWTEENKVNIVKMHQLSVTLSELVSLQNASHHLEPNMD
LINLLTLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPTKPVVPLEWASGVVPKPDPT
VINKHIRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMM
AYFLRAKSQLHCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQ
CKDLLVLACRRFARAPSLGSGHGSLPGSPSLPPVQDEVFEFPDVAAGHQDLDSRAITLVT
GSSRKISVRLQRATTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHDKAAKDKGFAKWEN
EKPRVQAGVDVVDRGTEFEPDQDEADMGETRQDGEDG
Download sequence
Identical sequences G1NXV6
ENSMLUP00000002222 ENSMLUP00000002222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]