SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NYE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NYE1
Domain Number 1 Region: 39-107
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000172
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  G1NYE1
Domain Number - Region: 194-237
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00195
Family Ubiquitin-related 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1NYE1
Sequence length 261
Comment (tr|G1NYE1|G1NYE1_MYOLU) Polycomb group ring finger 1 {ECO:0000313|Ensembl:ENSMLUP00000002428} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=PCGF1 OC=Vespertilionidae; Myotis.
Sequence
MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTI
TECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEE
KRIREFYQSRGLDRVTQPGGEEPALSNLGLPFCSFDHSKAHYYRYDEQLSLCLERLSPQS
GKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWL
SRWFGKPAPLLLQYSVKEKRR
Download sequence
Identical sequences G1NYE1
ENSMLUP00000002428 ENSMLUP00000002428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]