SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NYY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NYY0
Domain Number 1 Region: 66-314
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.38e-57
Family Glycerophosphoryl diester phosphodiesterase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NYY0
Sequence length 331
Comment (tr|G1NYY0|G1NYY0_MYOLU) Glycerophosphodiester phosphodiesterase 1 {ECO:0000313|Ensembl:ENSMLUP00000002642} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=GDE1 OC=Vespertilionidae; Myotis.
Sequence
MWLWETQGGLLGPFSFLLLLFLLVTRSPCNACLFTGILYLLLRLFSFEPLPARRALQVLQ
PRDRVSAIAHRGGCHDAPENTLAAIRQAAKNGATGVELDIEFTSDGVPVLMHDNTVDRTT
DGTGRICDLTFEQIRKLNPAANHRLRNDFPNEKIPTLREGVVESLNQNLTIFFDVKGHAN
KAIDALKKIYMEFPQLYNTSMVCSFLPEVIYKMRQTDRNVVTALTHRPWSLSHTGDGKPR
YDNMWKLSTFVVLDILLDWSMHNVLWYLCGISAFLVQKDSISPNYLKKWSAKGIQVVGWT
VNTFDEKSYYESYLGSSYITDSMLEDCPPHY
Download sequence
Identical sequences G1NYY0
XP_006088259.1.53796 ENSMLUP00000002642 ENSMLUP00000002642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]