SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1NZP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1NZP2
Domain Number 1 Region: 367-568
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.98e-49
Family Nucleotide and nucleoside kinases 0.00016
Further Details:      
 
Domain Number 2 Region: 207-309
Classification Level Classification E-value
Superfamily SH3-domain 1.28e-22
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 138-222
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-20
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 4 Region: 72-123
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000241
Family L27 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G1NZP2
Sequence length 575
Comment (tr|G1NZP2|G1NZP2_MYOLU) Membrane palmitoylated protein 3 {ECO:0000313|Ensembl:ENSMLUP00000002942} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=MPP3 OC=Vespertilionidae; Myotis.
Sequence
MPVLSEDSAGSQECLHETLALLTSQLRPDSNHKEEMGFLKDVFSEKSLSYLMKIHEKLRY
YERQSPTPVLHGAVALAEDVMEELQATSVHGDERELLQLLSTPHLRAMLMVHDTVAQKNF
DPVLPPLPDNIDEDFDEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSG
LVHVGDELREVNGITVLHKRPDEISQILAQSQGSITLKIIPATQEEDRLKESKVFMRALF
HYNPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSKQFQERQ
LRLHQPPLRFEVLQTLLIRLAGLRRSFRLGRRERLGNPQEGKTSAVTEAPELLTYEEVTR
YQHQPSKRPRLVVLIGSLGARLHELKQKVVAENPQHFGVAVPHTTRPRKSHEKEGVEYHF
VSKQAFEAGIHHNRFLEHGEYKENLYGTSLDAIHAVMAKNKVCLVDVEPDALRQLRTSEF
KPYIIFVKPAIQDKRKMPPMSPACEDIAAPLVFPDEEQREMSASAAFIDQHYGHLVDAVL
VREDLQSACSQLRALLENLSKDTHWVPISWVSFHE
Download sequence
Identical sequences G1NZP2
ENSMLUP00000002942 ENSMLUP00000002942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]