SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P015 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P015
Domain Number 1 Region: 83-201
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.98e-17
Family Ubiquitin-related 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P015
Sequence length 211
Comment (tr|G1P015|G1P015_MYOLU) Ubiquitin domain containing 2 {ECO:0000313|Ensembl:ENSMLUP00000003081} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=UBTD2 OC=Vespertilionidae; Myotis.
Sequence
VALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFES
NDHELAQAIIDGANITLPHGSLTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPE
PPPNSGYECQLRLRLSTGKDLKLVVRSTDTVYHMKRRLHSAEGVEPSSQRWFFSGRPLTD
KMKLEELKIPKDYVVQVIMSQPLQNPTPVEN
Download sequence
Identical sequences G1P015
ENSMLUP00000003081 ENSMLUP00000003081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]