SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P0B6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1P0B6
Domain Number - Region: 46-160
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0345
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P0B6
Sequence length 201
Comment (tr|G1P0B6|G1P0B6_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000003191} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
QGPLDEVIRKRLLIDGNDAGDDRRINLLVKSFIKWCNSGSQEEGYNQYQRMLSTLSQCEF
SMGKTLLIYDMNLREMESYEKIYKEIECSIAGAHEKIAECKKQILQAKRIQKNRQEYDAL
AKVIQHHPDRHETLKELEAMGKELEHLSHIKESVEDKLELRLKQFHVLLSTIHELQQTLE
NDEKLSELEEAQETNVDADPK
Download sequence
Identical sequences G1P0B6
ENSMLUP00000003191 ENSMLUP00000003191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]