SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P0F6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1P0F6
Domain Number - Region: 150-235
Classification Level Classification E-value
Superfamily PH domain-like 0.00123
Family TFIIH domain 0.029
Further Details:      
 
Domain Number - Region: 22-81
Classification Level Classification E-value
Superfamily PH domain-like 0.00523
Family GRAM domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P0F6
Sequence length 341
Comment (tr|G1P0F6|G1P0F6_MYOLU) Bardet-Biedl syndrome 5 {ECO:0000313|Ensembl:ENSMLUP00000003236} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=BBS5 OC=Vespertilionidae; Myotis.
Sequence
MSVLDALWEDRDVRFDVSPQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRLLVTNLRIIWH
SLALPRVNLSIGYNCILNITTRTANSKLRGQTEALYILTKCNSTRFEFIFTNLIPGSPRL
FTSVIAVHRAYETSKMYRDFKLRSALIQNKELRLLPQEHVYDKINGVWNLSSDQGNLGTF
FITNVRIVWHANMNDSFNVSIPYLQIRSIKIRDSKFGLALVIESSQQSGGYVLGFKIDPV
EKLQASVKEINSLHKVYSASPIFGVDYEMEEKPQPLEALTVEQIQDDVEIDSDDHPDAFV
AYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLWEVMS
Download sequence
Identical sequences G1P0F6
ENSMLUP00000003236 XP_014301037.1.53796 ENSMLUP00000003236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]