SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P0P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P0P1
Domain Number 1 Region: 147-347
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.63e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 31-143
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-31
Family Pleckstrin-homology domain (PH domain) 0.00000546
Further Details:      
 
Weak hits

Sequence:  G1P0P1
Domain Number - Region: 544-633
Classification Level Classification E-value
Superfamily Tropomyosin 0.0575
Family Tropomyosin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1P0P1
Sequence length 639
Comment (tr|G1P0P1|G1P0P1_MYOLU) Rho GTPase activating protein 25 {ECO:0000313|Ensembl:ENSMLUP00000003333} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=ARHGAP25 OC=Vespertilionidae; Myotis.
Sequence
MSLSQSACLLLSIARSRSVMTGEQMAAFHLSSTPNPLERPIKMGWLKKQRSIVKNWQQRY
FVLRAQQLYYYKDEEDTKPQGCMYLPGSTIKEIATNPEEAGKFVFEVIPASWDQSRTGQD
SYVLMASSQAEMEEWVKFLKRVAGTPSGAVFGQRLDETVAYEQKFGPHLVPILVEKCAEF
ILEHGLNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPV
VPWSQYEGFLLCGQLMNADEAKAQQELMKQLSTLPRDNYSLLSYICRFLHEIQLNCAVNK
MSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDVPLSPPAP
KNDPKKPPVARSSVGWDASEDVPISRTDSFSNTASDSEATSPTEQQPSDMFPEHSSKTPR
EKPGDWKLQSRKRTQTLPNRKCFLTAAFQGANSSKVEIFKNEFWSSSSEAKAGEGHRRTL
SQGVQNFSDAQRTSTYDNIPTLPGSPGNEAGALASHACDSKRDSLSSPNSETGPGTKNSG
EEGLESLQKTVQELQKEIETQKQDYEEQIKSLEKENYDVWAKVVRLNEELEKEKKKSAAL
EISLRNMERSREDVERRNKTLEEEVKEFVKSMKEPKADA
Download sequence
Identical sequences G1P0P1
ENSMLUP00000003333 ENSMLUP00000003333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]