SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P0S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P0S1
Domain Number 1 Region: 3-108
Classification Level Classification E-value
Superfamily CAD & PB1 domains 6.87e-21
Family PB1 domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G1P0S1
Sequence length 400
Comment (tr|G1P0S1|G1P0S1_MYOLU) TRK-fused gene {ECO:0000313|Ensembl:ENSMLUP00000003366} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=TFG OC=Vespertilionidae; Myotis.
Sequence
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVIIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DCLEPPGEPGPSTSIPENDTMDGREEKPAASDSSGKQSTQVMAASMSAFDPLKNQDEISK
NVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQS
EGQMYQQYPQQAGYGAQQPQAPPQPAQQYGIQYSAGYSQQTGPQQPQQFQGYGQQATSQA
QAAAFSGQPQQLPAQQPQQYQASNYPPHTYATQTSQPTNYTVAPASQPGMAPSQAGAYQP
RPGFTQSASTITPPPSGPNPYARNRPPFGQGYTQPGPGYR
Download sequence
Identical sequences G1P0S1
ENSMLUP00000003366 ENSMLUP00000003366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]