SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P140 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G1P140
Domain Number - Region: 279-318
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.0316
Family AlkB-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P140
Sequence length 411
Comment (tr|G1P140|G1P140_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000003514} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
NPNVSCLSETRASPEKLRLFEELEDTWLPYLTPKDDEFYQQWQLKYPKLVLREAGSVPEE
LHREAQAAFATLHQHGCLARDLVRVQGKDVLTPVARLLVGNPGCTYKYLNTRLFAVPWPV
RGSNITYHQAEVAAACQTLLSLNSYLQLETVQAWEELVAKERANIDEVPVCIGPDFGLGI
FDGPDEADIRSRSAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRSAVAV
YSHSCEGPEEESDEDSPLEGRDPDTWHVGFKISWDIETPGLAIPLHQGDCYFMLDDLNAT
HQHCVLAGLPPRFSSTHRVAECSTGTLDYILQRCQLALQNVGDVTDSGGVSLKSLEPAVL
KQGEEIHNEVEFEWLRQFWFQGSRPRKCTDWWCQPMAQLEEMWRKMEGVVS
Download sequence
Identical sequences G1P140
ENSMLUP00000003514 ENSMLUP00000003514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]