SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P1M9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P1M9
Domain Number 1 Region: 226-484
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.14e-53
Family Glycerophosphoryl diester phosphodiesterase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P1M9
Sequence length 610
Comment (tr|G1P1M9|G1P1M9_MYOLU) Glycerophosphodiester phosphodiesterase domain containing 5 {ECO:0000313|Ensembl:ENSMLUP00000003730} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=GDPD5 OC=Vespertilionidae; Myotis.
Sequence
MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTVTFGLTLTWLY
FWWEVHNDYNEFNWYLYNRLGYWSDWSVPILMTAATAFTYIAGLLVLALCHIAVGQQMNL
HWLHKMGLVVILVSTVVAMSAMAQLWEDEWEVLLISLQGTAPFLHMGALAAVTALSWIVA
GQFARAERSSSQMAILCIFSAVVFALYLAPLTISSPCIMEKKDLGPKPALIGHRGVPMLA
PEHTLMSFRKALEHKLYGLQADVTISLDGVPFLMHDTTLRRTTNVEEAFPELAHRPASML
NWTVLQRLNAGQWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLALAKGNATLLLNLR
DPPRDHPYRASFLNITLEALLRSGFPQHQVMWLPNRQRPFVRKVAPGFQQTSGSKEEATS
LHRGHIQWLNLRYTQVSRQELRDYASWNLSVNLYTVNTPWLFSLLWCMGVPSVTSDNSHT
LSQVPFPLWIMPPDEYCLMWVTADLISFTLIVGIFVLQNYHLIRWRLGGIRSYNPEQIML
NAAVHRTSRDVSIMKEKLIFSEISDGMEVSDELSVCSDNSYDTYANSASTPVDPRGTGSH
TKTLADRSGR
Download sequence
Identical sequences G1P1M9
XP_014323704.1.53796 ENSMLUP00000003730 ENSMLUP00000003730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]