SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P207 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P207
Domain Number 1 Region: 340-496
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-34
Family SPRY domain 0.00022
Further Details:      
 
Domain Number 2 Region: 4-92
Classification Level Classification E-value
Superfamily RING/U-box 9.72e-26
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 3 Region: 87-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.51e-17
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P207
Sequence length 505
Comment (tr|G1P207|G1P207_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000003880} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN=LOC102431987 OC=Vespertilionidae; Myotis.
Sequence
MASEILVNIKEMMTCPICLGILKEPRSLDCGHSFCQACITANNKESVNGQGESSCPVCRI
SYQPENLRPSLHLANIVEVLREVKLSPEEDQKSDLCVHHGEKLLLFCQEDGKIICWLCER
SQEHRGHQTFLIEEITQECKEKLQKALDSLSAKQQEAEKLRADLEKETTSWKDLIENEIQ
SIQDYFKELRGILDSEEQKELQRLEKEERDVLSYLAQGGSELIQKGQLLRDLTWDLQRRL
QGSTAEMLQDVNGILESPRSKTFTLKKLKTLPKKQRRVFQVPDLRGMLQVFNELAVVRRY
WGSYSFYSDDLSCNVISNTNMTLNHRSNVDISAHKRNGRGDFYRRALCPPEREDYVVLGF
PSITSGKHYWEVDVPKNKDWILGVCIRKYPDFTGIDFGGKNKPVSFQYQPQNGYWVIGLQ
NYSEYQAFVNSSYSNPSPLTLFVTVPPDRIGVFLDFAACTISFLNITNHGFLIYKFSSCR
FYQEIYPYFNSMEYPGSLKLVSPSS
Download sequence
Identical sequences G1P207
ENSMLUP00000003880 ENSMLUP00000003880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]