SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G1P2B4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G1P2B4
Domain Number 1 Region: 294-474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-64
Family SPRY domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 9-87
Classification Level Classification E-value
Superfamily RING/U-box 4.57e-19
Family RING finger domain, C3HC4 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G1P2B4
Sequence length 498
Comment (tr|G1P2B4|G1P2B4_MYOLU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMLUP00000004000} KW=Complete proteome; Reference proteome OX=59463 OS=Myotis lucifugus (Little brown bat). GN= OC=Vespertilionidae; Myotis.
Sequence
MAAGSAGQRLREEARCPVCLDLLQDPVSVDCGHSFCLRCISEFCDRAAGEQGGLFACPQC
RGPLRREGFRPKRQLASLVPAWRQRLLPRTWCPPPRASPACPGHSAPRPHRPCPHCPLSP
TSARPWHSPREKSPSHSAHSESTIQSMAIKYQVKLQMALELVRKEMEEALTQEANVGKKT
VIWKEKVETQRQRFRLEFEKYRGFLALEEQLQLRRLEQEERATLQRLREGQRQLAQRGRA
LRELAQELEDRCRLPALDLLEGARGTLSRSKSVTQLEPEAIPLELKTMCRIPGMREMLRK
FQVDVKLDPATAHPSLLLTADLRSVQDGELWRDVPNNPERFDTWPCILGLQNFSSGRHYW
EVMVGERAEWGLGVSQDSVSRKGETTPSPENGVWAMWLLKENEYMVLASPSVPLLHLERP
RRIGIFLDYEAGEISFYDITNGSYIYTFSQLFNGVLRPYFFVCDTTPLVLPPMTEAESGN
SAASSHPNPASNIRDDHS
Download sequence
Identical sequences G1P2B4
ENSMLUP00000004000 ENSMLUP00000004000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]